Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 71B1
LigandBDBM50281349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_921512
IC50 12000±n/a nM
Citation Lamb, DCKelly, DEHanley, SZMehmood, ZKelly, SL Glyphosate is an inhibitor of plant cytochrome P450: functional expression of Thlaspi arvensae cytochrome P45071B1/reductase fusion protein in Escherichia coli. Biochem Biophys Res Commun244:110-4 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 71B1
Name:Cytochrome P450 71B1
Synonyms:1.14.-.- | CYP71B1 | CYPLXXIB1 | Cytochrome P450 71B1
Type:PROTEIN
Mol. Mass.:56394.77
Organism:Thlaspi arvense
Description:ChEMBL_105549
Residue:496
Sequence:
MDLLYIVAALVIFASLLIAKSKRKPKKNLPPGPPRLPIIGNLHQLGEKPHRAMVELSKTY
GPLMSLKLGSVTTVVATSVETVRDVLKTYDLECCSRPYMTYPARITYNLKDLVFSPYDKY
WRQVRKLTVVELYTAKRVQSFRHIREEEVASFVRFNKQAASSEETVNLSQKILKMSGSVI
CRIGFGINLEGSKLENTYQEIIVQAFEVLGSLAAVDYFPVIGTIIDRITGLHAKCEKVFH
GIDSFFDQAIQRHIDDPSIKDDIIDLLLKMERGEGSLGEYELTREHTKGILMNILTAGID
TSAQTMTWAMTHLLANPRVMKKLQAEIREKIKNIDEITDDDVEQLDYFKLVLKETFRISP
IVPVLVPRVAAKDLKIAGYDVPEKTWIHVNMWAVHMSPSIWKDPETFNPERFIDNQTDFK
GLNFELLPFGSGRRMCPGMGMGLAVVHLTLINLLYRFDWKLPNGMKAEELSIEENYGLIC
VKKLPLEAIPVLTQWT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281349
NameBDBM50281349
Synonyms:CHEMBL95764 | N-(phosphonomethyl)glycine | glyphosate
TypeSmall organic molecule
Emp. Form.C3H8NO5P
Mol. Mass.169.0731
SMILESOC(=O)CNCP(O)(O)=O
Structure
n/a