Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLaforin
LigandBDBM50498446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1506353
IC50 56000±n/a nM
Citation He, RBai, YYu, ZHWu, LGunawan, AMZhang, ZY Diversity-Oriented Synthesis for Novel, Selective and Drug-like Inhibitors for a Phosphatase from Mycobacterium Tuberculosis. Medchemcomm5:1496-1499 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Laforin
Name:Laforin
Synonyms:EPM2A | LAFPTPase | Lafora PTPase | Laforin
Type:Protein
Mol. Mass.:37158.16
Organism:Homo sapiens (Human)
Description:O95278
Residue:331
Sequence:
MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGDGALALQEPGLW
LGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDG
VYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKL
KHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEG
RVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKR
PAVYIDEEALARAQEDFFQKFGKVRSSVCSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50498446
NameBDBM50498446
Synonyms:CHEMBL3596431
TypeSmall organic molecule
Emp. Form.C14H9BrN2O3S
Mol. Mass.365.202
SMILESOC(=O)c1cc2sc(Nc3cccc(Br)c3)nc2cc1O
Structure
n/a