Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransmembrane domain-containing protein TMIGD3
LigandBDBM50500485
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1543581
Ki 550±n/a nM
Citation Ranganathan, AStoddart, LAHill, SJCarlsson, J Fragment-Based Discovery of Subtype-Selective Adenosine Receptor Ligands from Homology Models. J Med Chem58:9578-90 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transmembrane domain-containing protein TMIGD3
Name:Transmembrane domain-containing protein TMIGD3
Synonyms:TMIGD3 | Transmembrane domain-containing protein TMIGD3
Type:PROTEIN
Mol. Mass.:30335.79
Organism:Homo sapiens (Human)
Description:ChEMBL_114868
Residue:266
Sequence:
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW
LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF
SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA
NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR
NRRVGNTLKPFSRVLTPKEMAPTEQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50500485
NameBDBM50500485
Synonyms:CHEMBL3745803
TypeSmall organic molecule
Emp. Form.C12H10N2O2S
Mol. Mass.246.285
SMILESCCc1cc2c(nc([nH]c2=O)-c2ccoc2)s1
Structure
n/a