Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATPase family AAA domain-containing protein 2B
LigandBDBM50504159
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1813645
IC50 501±n/a nM
Citation Bamborough, PChung, CWDemont, EHBridges, AMCraggs, PDDixon, DPFrancis, PFurze, RCGrandi, PJones, EJKaramshi, BLocke, KLucas, SCCMichon, AMMitchell, DJPogány, PPrinjha, RKRau, CRoa, AMRoberts, ADSheppard, RJWatson, RJ A Qualified Success: Discovery of a New Series of ATAD2 Bromodomain Inhibitors with a Novel Binding Mode Using High-Throughput Screening and Hit Qualification. J Med Chem62:7506-7525 (2019) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATPase family AAA domain-containing protein 2B
Name:ATPase family AAA domain-containing protein 2B
Synonyms:ATAD2B | ATPase family AAA domain-containing protein 2B | KIAA1240
Type:PROTEIN
Mol. Mass.:164918.65
Organism:Homo sapiens (Human)
Description:ChEMBL_105350
Residue:1458
Sequence:
MVNTRKSSLRLLGSKSPGPGPGPGAGAEPGATGGSSHFISSRTRSSKTRAASCPAAKAGG
SGGAGVTLDEARKVEVDGSLSDSHVSPPAKRTLKQPDSVCKDKSKSRSTGQREEWNLSTG
QARLTSQPGATLPNGHSGLSLRSHPLRGEKKGDGDLSCINGDMEVRKSCRSRKNRFESVN
QSLLFDQLVNSTAEAVLQEMDNINIRQNRRSGEVERLRMWTDTEFENMDMYSRVKRRRKS
LRRNSYGIQNHHEVSTEGEEEESQEEDGDIEVEEAEGEENDRPYNLRQRKTVDRYQAPPI
VPAHQKKRENTLFDIHRSPARRSHIRRKKHAIHSSDTTSSDEERFERRKSKSMARARNRC
LPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSIGGLSHHIHALKEMVVFPL
LYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKKVAFFMRKGADCLSKWV
GESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRG
EIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQKARKHILQIHTRDWNPKLSDAFLGE
LAEKCVGYCGADIKALCTEAALIALRRRYPQIYASSHKLQLDVSSIVLSAQDFYHAMQNI
VPASQRAVMSSGHALSPIIRPLLERSFNNILAVLQKVFPHAEISQSDKKEDIETLILEDS
EDENALSIFETNCHSGSPKKQSSSAAIHKPYLHFTMSPYHQPTSYRPRLLLSGERGSGQT
SHLAPALLHTLERFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPHIGDWW
EAVSETVRATFLTLLQDIPSFSPIFLLSTSETMYSELPEEVKCIFRIQYEEVLYIQRPIE
EDRRKFFQELILNQASMAPPRRKHAALCAMEVLPLALPSPPRQLSESEKSRMEDQEENTL
RELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTA
KDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKE
ARIKRGLSVTSEQINPHSTGARKTETRVEEAFRHKQRNPMDVWHNSANKCAFRVRRKSRR
RSQWGKGIIKKRKVNNLKKDEEDTKFADYENHTEDRKLLENGEFEVSTDCHEENGEETGD
LSMTNDESSCDIMDLDQGQRLNNGAGTKENFASTEEESSNESLLVNSSSSLNPEQTSRKE
TFLKGNCLNGEASTDSFEGIPVLECQNGKLEVVSFCDSGDKCSSEQKILLEDQSKEKPET
STENHGDDLEKLEALECSNNEKLEPGSDVEVKDAELDKEGASKVKKYRKLILEQAKTTSL
ELVPEEPSEPVPPLIVDRERLKKLLDLLVDKSNNLAVDQLERLYSLLSQCIYRHRKDYDK
SQLVEEMERTVHMFETFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50504159
NameBDBM50504159
Synonyms:CHEMBL4583297
TypeSmall organic molecule
Emp. Form.C20H25BrN4O5S
Mol. Mass.513.405
SMILESCC1(NC(=O)N(CC(=O)Nc2ccc(Br)c(c2)S(=O)(=O)N2CCCCC2)C1=O)C1CC1
Structure
n/a