Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50056900
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90710
IC50>100000±n/a nM
Citation Zhao, HNeamati, NSunder, SHong, HWang, SMilne, GWPommier, YBurke, TR Hydrazide-containing inhibitors of HIV-1 integrase. J Med Chem40:937-41 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056900
NameBDBM50056900
Synonyms:2-Carbamoylphenol | 2-Carboxamidophenol | 2-Hydroxybenzamide | CHEMBL27577 | OHB | Salicylic Acid amide | o-Hydroxybenzamide
TypeSmall organic molecule
Emp. Form.C7H7NO2
Mol. Mass.137.136
SMILESNC(=O)c1ccccc1O
Structure
n/a