Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase Complex 1
LigandBDBM50242401
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1849764
EC50 800±n/a nM
Citation Babkov, DAZhukowskaya, ONBorisov, AVBabkova, VASokolova, EVBrigadirova, AALitvinov, RAKolodina, AAMorkovnik, ASSochnev, VSBorodkin, GSSpasov, AA Towards multi-target antidiabetic agents: Discovery of biphenyl-benzimidazole conjugates as AMPK activators. Bioorg Med Chem Lett29:2443-2447 (2019) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase Complex 1
Name:5'-AMP-activated protein kinase Complex 1
Synonyms:AMP-activated protein kinase (AMPK) alpha-1/beta-1/gamma-1 | AMPK alpha1/beta1/gamma1 | AMPK complex 1 (alpha-1,beta-1,gamma-1) | Adenosine monophosphate-activated protein kinase (AMPK gamma 1, beta 1 and alpha 1)
Type:n/a
Mol. Mass.:n/a
Description:n/a
Components:This complex has 0 components.
Component 1
Name:5'-AMP-activated protein kinase subunit beta-1
Synonyms:5'-AMP-activated protein kinase subunit beta-1 | AMP-activated protein kinase alpha-2/beta-1/gamma-3 | AMPK subunit beta-1 | AMPKb
Type:n/a
Mol. Mass.:30380.94
Organism:Homo sapiens (Human)
Description:Q9Y478
Residue:270
Sequence:
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:5'-AMP-activated protein kinase subunit gamma-1
Synonyms:5'-AMP-activated protein kinase subunit gamma-1 | AMP-activated protein kinase, gamma-1 subunit | AMPK alpha2/beta2/gamma1 | AMPK gamma-1 | AMPK gamma1 | AMPK subunit gamma-1 | AMPKg | PRKAG1
Type:n/a
Mol. Mass.:37581.44
Organism:Homo sapiens (Human)
Description:P54619
Residue:331
Sequence:
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:5'-AMP-activated protein kinase catalytic subunit alpha-1
Synonyms:ACACA kinase | AMP-activated protein kinase alpha-1/beta-2/gamma-2 | AMP-activated protein kinase, alpha-1 subunit | AMPK subunit alpha-1 | AMPK-alpha1 | Hydroxymethylglutaryl-CoA reductase kinase | Tau-protein kinase PRKAA1
Type:Protein
Mol. Mass.:64023.62
Organism:Homo sapiens (Human)
Description:Q13131
Residue:559
Sequence:
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50242401
NameBDBM50242401
Synonyms:4-hydroxy-3-(2'-hydroxybiphenyl-4-yl)-6-oxo-6,7-dihydrothieno[2,3-b]pyridine-5-carbonitrile | A-769662 | CHEMBL512504
TypeSmall organic molecule
Emp. Form.C20H12N2O3S
Mol. Mass.360.386
SMILESOc1ccccc1-c1ccc(cc1)-c1csc2[nH]c(=O)c(C#N)c(O)c12
Structure
n/a