Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene C4 synthase
LigandBDBM50519569
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1876790
IC50 14±n/a nM
Citation Munck Af Rosenschöld, MJohannesson, PNikitidis, ATyrchan, CChang, HFRönn, RChapman, DUllah, VNikitidis, GGlader, PKäck, HBonn, BWågberg, FBjörkstrand, EAndersson, USwedin, LRohman, MAndreasson, TBergström, ELJiang, FZhou, XHLundqvist, AJMalmberg, AEk, MGordon, EPettersen, ARipa, LDavis, AM Discovery of the Oral Leukotriene C4 Synthase Inhibitor (1 J Med Chem62:7769-7787 (2019) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene C4 synthase
Name:Leukotriene C4 synthase
Synonyms:LTC4 synthase | LTC4S | Leukotriene-C(4) synthase
Type:PROTEIN
Mol. Mass.:16575.59
Organism:Homo sapiens (Human)
Description:ChEMBL_961179
Residue:150
Sequence:
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50519569
NameBDBM50519569
Synonyms:CHEMBL4545950
TypeSmall organic molecule
Emp. Form.C22H20F4N2O4
Mol. Mass.452.3988
SMILESCOc1cc(cnc1C(=O)[C@H]1C[C@@H]1C(O)=O)N(CC1CC1)c1cc(ccc1F)C(F)(F)F |r|
Structure
n/a