Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlanyl-tRNA synthetase
LigandBDBM50075064
Substrate/Competitorn/a
Meas. Tech.ChEBML_30528
IC50>100000±n/a nM
Citation Yu, XYHill, JMYu, GWang, WKluge, AFWendler, PGallant, P Synthesis and structure-activity relationships of a series of novel thiazoles as inhibitors of aminoacyl-tRNA synthetases. Bioorg Med Chem Lett9:375-80 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alanyl-tRNA synthetase
Name:Alanyl-tRNA synthetase
Synonyms:AlaRS | Alanine--tRNA ligase | Alanyl-tRNA synthetase, cytoplasmic | Renal carcinoma antigen NY-REN-42
Type:PROTEIN
Mol. Mass.:106792.58
Organism:Homo sapiens (Human)
Description:ChEMBL_30528
Residue:968
Sequence:
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIERLYVTYFGGDEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEV
TDDSPKYNYHLDSSGSYVFENTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRP
IMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAK
VKAQTAPNKDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKR
VLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075064
NameBDBM50075064
Synonyms:((S)-2-Amino-3-methyl-butyryl)-sulfamic acid (2R,3S,4R,5R)-3,4-dihydroxy-5-(4-phenyl-thiazol-2-yl)-tetrahydro-furan-2-ylmethyl ester | CHEMBL124856
TypeSmall organic molecule
Emp. Form.C19H25N3O7S2
Mol. Mass.471.548
SMILESCC(C)[C@H](N)C(=O)NS(=O)(=O)OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)c1nc(cs1)-c1ccccc1
Structure
n/a