Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine Binding protein
LigandBDBM50520724
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1881879
IC50 106±n/a nM
Citation Yang, XShen, JJiang, LLi, WYu, MPan, GYan, YZhang, CJia, WXiao, LYu, HChen, HZheng, YYu, LXie, QZhou, LShao, L Discovery, cocrystallization and biological evaluation of novel piperidine derivatives as high affinity Ls-AChBP ligands possessing ?7 nAChR activities. Eur J Med Chem160:37-48 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine Binding protein
Name:Acetylcholine Binding protein
Synonyms:ACh-binding protein | Acetylcholine-binding protein | Acetylcholine-binding protein (AchBP) | Acetylcholine-binding protein (Ls-AchBP) | AchBP
Type:n/a
Mol. Mass.:26055.52
Organism:Lymnaea stagnalis
Description:Soluble acetylcholine receptor
Residue:229
Sequence:
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50520724
NameBDBM50520724
Synonyms:CHEMBL4559828
TypeSmall organic molecule
Emp. Form.C18H20Cl2N2O
Mol. Mass.351.27
SMILESClc1ccc(CC2(COc3cccnc3)CCNCC2)cc1Cl
Structure
n/a