Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhylloquinone omega-hydroxylase CYP4F2
LigandBDBM50527962
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1904213
IC50 647000±n/a nM
Citation Kowalski, JPMcDonald, MGPelletier, RDHanenberg, HWiek, CRettie, AE Design and Characterization of the First Selective and Potent Mechanism-Based Inhibitor of Cytochrome P450 4Z1. J Med Chem63:4824-4836 (2020) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phylloquinone omega-hydroxylase CYP4F2
Name:Phylloquinone omega-hydroxylase CYP4F2
Synonyms:20-HETE synthase | 20-hydroxyeicosatetraenoic acid synthase | Arachidonic acid omega-hydroxylase | CYP4F2 | CYPIVF2 | Cytochrome P450 4F2 | Cytochrome P450-LTB-omega | Leukotriene-B(4) 20-monooxygenase 1 | Leukotriene-B(4) omega-hydroxylase 1
Type:PROTEIN
Mol. Mass.:59859.32
Organism:Homo sapiens (Human)
Description:ChEMBL_10743
Residue:520
Sequence:
MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF
WGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPK
DKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL
LASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHHEIL
LHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID
VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE
LLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC
LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKV
VLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50527962
NameBDBM50527962
Synonyms:CHEMBL4442292
TypeSmall organic molecule
Emp. Form.C12H16N4O2
Mol. Mass.248.281
SMILESOC(=O)CCCCCNn1nnc2ccccc12
Structure
n/a