Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine 3-monooxygenase
LigandBDBM50083951
Substrate/Competitorn/a
Meas. Tech.ChEMBL_91745
IC50 2100±n/a nM
Citation Drysdale, MJHind, SLJansen, MReinhard, JF Synthesis and SAR of 4-aryl-2-hydroxy-4-oxobut-2-enoic acids and esters and 2-amino-4-aryl-4-oxobut-2-enoic acids and esters: potent inhibitors of kynurenine-3-hydroxylase as potential neuroprotective agents. J Med Chem43:123-7 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine 3-monooxygenase
Name:Kynurenine 3-monooxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:54371.88
Organism:Rattus norvegicus
Description:ChEMBL_1487468
Residue:478
Sequence:
MASSDTEGKRVVVIGGGLVGALNACFLAKRNFQVDVYEAREDIRVANFMRGRSINLALSY
RGRQALKAVGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISREKLNKDLLT
AVESYPNAKVHFGHKLSKCCPEEGILTMLGPNKVPRDITCDLIVGCDGAYSTVRAHLMKK
PRFDYSQQYIPHGYMELTIPPKNGEYAMEPNCLHIWPRNAFMMIALPNMDKSFTCTLFMS
FEEFEKLPTHSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSRCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDLSVCLPEFSRFRIPDDHAISDLS
MYNYIEMRAHVNSRWFLFQRLLDKFLHALMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKK
VINRGLFVLGSLVAIGSAYILVHHLSPRPLELLRSAWTGTSGHWNRSADISPRVPWSH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50083951
NameBDBM50083951
Synonyms:4-(3-Bromo-phenyl)-2-hydroxy-4-oxo-but-2-enoic acid methyl ester | CHEMBL283135
TypeSmall organic molecule
Emp. Form.C11H9BrO4
Mol. Mass.285.091
SMILESCOC(=O)C(=O)CC(=O)c1cccc(Br)c1
Structure
n/a