Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDitrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
LigandBDBM50533424
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1925558
IC50>100000±n/a nM
Citation Concha, NHuang, JBai, XBenowitz, ABrady, PGrady, LCKryn, LHHolmes, DIngraham, KJin, QPothier Kaushansky, LMcCloskey, LMesser, JAO'Keefe, HPatel, ASatz, ALSinnamon, RHSchneck, JSkinner, SRSummerfield, JTaylor, ATaylor, JDEvindar, GStavenger, RA Discovery and Characterization of a Class of Pyrazole Inhibitors of Bacterial Undecaprenyl Pyrophosphate Synthase. J Med Chem59:7299-304 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
Name:Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
Synonyms:2.5.1.31 | A7M90_02080 | A9843_06625 | AA954_14460 | AB552B1_00058 | AB945B12_03757 | ABCAM1_2216 | ABKPCSM17A_03582 | B4R90_04635 | B9W69_06885 | B9X95_06890 | CEJ64_16105 | CSB70_2045 | DLI67_15270 | DLI75_14575 | DOL94_09555 | DVA69_08535 | Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) | Ditrans,polycis-undecaprenylcistransferase | E2533_12390 | E2535_15455 | E2540_17390 | EA667_008525 | EA685_17420 | EA722_15190 | EWO92_00565 | EWO96_03250 | EWP49_03250 | F4T91_10800 | F4U04_16830 | F8B16_06655 | FD913_10490 | FGL68_10105 | FJU36_14470 | FJU42_12680 | FJU76_03480 | FJU79_02235 | FJU87_09105 | FJV14_08965 | G3N45_12450 | GSE42_11690 | GUK62_13735 | LV38_00732 | NCTC13305_00281 | NCTC13420_00699 | SAMEA104305318_03206 | Synonyms=cpsA | UDS | UPP synthase | Undecaprenyl diphosphate synthase | Undecaprenyl pyrophosphate synthase | ispU | uppS
Type:PROTEIN
Mol. Mass.:28690.62
Organism:Acinetobacter baumannii
Description:ChEMBL_119654
Residue:250
Sequence:
MTDSEEYHLPQHVAIIMDGNNRFAKKNQMQKGDGHREGKNVLDPIVEHCVKTGVRALTVF
AFSSENWNRPQYEVDLLMKLLEETIHEQIPRMKKFNIALRFIGDRSRLPSHLVALMEDAE
QQTAHHDAMTLTIAVSYGGMWDIANAAKQVAQAVSRGEIDADQINVDLFEKYVSLNDLPA
VDLLIRTGGDFRISNFLLWQAAYAELYFTDTLWPEFTVEEFDHALNVFSGRERRFGKTSE
QIQQEKIEKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50533424
NameBDBM50533424
Synonyms:CHEMBL4574148
TypeSmall organic molecule
Emp. Form.C32H32N4O3S
Mol. Mass.552.686
SMILESCC(C)Oc1ccc(CN(CCC(N)=O)C(=O)c2cnn(Cc3ccccc3)c2-c2ccc3sccc3c2)cc1
Structure
n/a