Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase HD2
LigandBDBM50009834
Substrate/Competitorn/a
Meas. Tech.ChEMBL_87549
IC50 128000±n/a nM
Citation Mai, AMassa, SCerbara, IValente, SRagno, RBottoni, PScatena, RLoidl, PBrosch, G 3-(4-Aroyl-1-methyl-1H-2-pyrrolyl)-N-hydroxy-2-propenamides as a new class of synthetic histone deacetylase inhibitors. 2. Effect of pyrrole-C2 and/or -C4 substitutions on biological activity. J Med Chem47:1098-109 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase HD2
Name:Histone deacetylase HD2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:30785.07
Organism:Zea mays
Description:ChEMBL_87549
Residue:286
Sequence:
MEVGGQEVKPGATVSCKVGDGLVIHLSQAALGESKKASENAILSVNIDDKKLVLGTLSVE
KHPQISCDLVFDKDFELPHNSKTRSVFFRGYKSPVPLFESNSGEDSSDEELKTDQIPLQN
NEIKISAAKVPAKDDDDDVFIILAMMMMIYSSDDDDDDFTTSDSDNEMSEEDDSSDEDEM
SEEDDSSDEDEMSGGADPSDDSSDESGSEHTSAPKKTDVVVGKKRAIKAEAPYGKKAKSE
QSSQKTGDKASTSHPAKQSIKTPADKSRKTPTADKKSPKSGSHGCK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009834
NameBDBM50009834
Synonyms:2-Propylvaleric acid sodium salt | CHEMBL433 | Depakene | Depakote | Divalproex | Divalproex sodium | Epilim | VALPROATE SODIUM | sodium 2-propylpentanoate | sodium valproate
TypeSmall organic molecule
Emp. Form.C8H15O2
Mol. Mass.143.204
SMILESCCCC(CCC)C([O-])=O
Structure
n/a