Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel subunit Kv7.2
LigandBDBM50143558
Substrate/Competitorn/a
Meas. Tech.ChEBML_91716
EC50 1300±n/a nM
Citation Wu, YJBoissard, CGChen, JFitzpatrick, WGao, QGribkoff, VKHarden, DGHe, HKnox, RJNatale, JPieschl, RLStarrett, JESun, LQThompson, MWeaver, DWu, DDworetzky, SI (S)-N-[1-(4-cyclopropylmethyl-3,4-dihydro-2H-benzo[1,4]oxazin-6-yl)-ethyl]-3-(2-fluoro-phenyl)-acrylamide is a potent and efficacious KCNQ2 opener which inhibits induced hyperexcitability of rat hippocampal neurons. Bioorg Med Chem Lett14:1991-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel subunit Kv7.2
Name:Voltage-gated potassium channel subunit Kv7.2
Synonyms:KQT-like 2 | Potassium channel subunit alpha KvLQT2 | Potassium voltage-gated channel subfamily KQT member 2
Type:PROTEIN
Mol. Mass.:84494.02
Organism:Mus musculus
Description:ChEMBL_990142
Residue:759
Sequence:
MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSVLSKPRTG
GAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRPKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTW
QYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPSQKVSLKDRVFSSPR
GMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRIKGAASRQNSE
EASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRPYDVMDV
IEQYSAGHLDMLSRIKSLQSRIDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSPRVDH
IVGRGPTITDKDRTKGPAETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIP
PAETEAYFGAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQ
CPPSTSWQQSHQRHGTSPVGDHGSLVLRLERSAGMMSCH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50143558
NameBDBM50143558
Synonyms:CHEMBL41355 | EZOGABINE | N-(2-amino-4-(4-fluorobenzylamino)-phenyl)carbamic acid ethylester | RETIGABINE | [2-Amino-4-(4-fluoro-benzylamino)-phenyl]-carbamic acid ethyl ester
TypeSmall organic molecule
Emp. Form.C16H18FN3O2
Mol. Mass.303.3314
SMILESCCOC(=O)Nc1ccc(NCc2ccc(F)cc2)cc1N
Structure
n/a