Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutathione reductase
LigandBDBM50015950
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305846
pH7.4±n/a
IC50 441000±n/a nM
Commentsextracted
Citation Seefeldt, TDwivedi, CPeitz, GHerman, JCarlson, LZhang, ZGuan, X 2-Acetylamino-3-[4-(2-acetylamino-2-carboxyethylsulfanylcarbonylamino)- phenylcarbamoylsulfanyl]propionic acid and its derivatives as a novel class of glutathione reductase inhibitors. J Med Chem48:5224-31 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutathione reductase
Name:Glutathione reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53448.83
Organism:Saccharomyces cerevisiae
Description:ChEMBL_700053
Residue:483
Sequence:
MLSATKQTFRSLQIRTMSTNTKHYDYLVIGGGSGGVASARRAASYGAKTLLVEAKALGGT
CVNVGCVPKKVMWYASDLATRVSHANEYGLYQNLPLDKEHLTFNWPEFKQKRDAYVHRLN
GIYQKNLEKEKVDVVFGWARFNKDGNVEVQKRDNTTEVYSANHILVATGGKAIFPENIPG
FELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECI
QNTITDHYVKEGINVHKLSKIVKVEKNVETDKLKIHMNDSKSIDDVDELIWTIGRKSHLG
MGSENVGIKLNSHDQIIADEYQNTNVPNIYSLGDVVGKVELTPVAIAAGRKLSNRLFGPE
KFRNDKLDYENVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKFTAMYYAMLSEKS
PTRYKIVCAGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEELV
TMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015950
NameBDBM50015950
Synonyms:1,3-bis(2-chloroethyl)-1-nitrosourea | Bicnu (TN) | CARMUSTINE | CHEMBL513 | Gliadel | N,N'-Bis(2-chloroethyl)-N-nitrosourea
TypeSmall organic molecule
Emp. Form.C5H9Cl2N3O2
Mol. Mass.214.05
SMILESClCCNC(=O)N(CCCl)N=O
Structure
n/a