Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-dehydroquinate dehydratase
LigandBDBM14672
Substrate/Competitorn/a
Meas. Tech.ChEMBL_332876
Kd 2500±n/a nM
Citation Robinson, DAStewart, KAPrice, NCChalk, PACoggins, JRLapthorn, AJ Crystal structures of Helicobacter pylori type II dehydroquinase inhibitor complexes: new directions for inhibitor design. J Med Chem49:1282-90 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-dehydroquinate dehydratase
Name:3-dehydroquinate dehydratase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:18479.08
Organism:Helicobacter pylori
Description:ChEMBL_766424
Residue:167
Sequence:
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIID
KIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGA
ACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNNPNNPINNQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14672
NameBDBM14672
Synonyms:2-hydroxypropane-1,2,3-tricarboxylic acid | CHEMBL1261 | CITRIC ACID | Citrate | Citric Acid | Fragment 2 | cid_311
TypeSmall organic molecule
Emp. Form.C6H8O7
Mol. Mass.192.1235
SMILESOC(=O)CC(O)(CC(O)=O)C(O)=O
Structure
n/a