Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA-C receptor
LigandBDBM50240386
Substrate/Competitorn/a
Meas. Tech.ChEMBL_554600
IC50 12900±n/a nM
Citation Kumar, RJChebib, MHibbs, DEKim, HLJohnston, GASalam, NKHanrahan, JR Novel gamma-aminobutyric acid rho1 receptor antagonists; synthesis, pharmacological activity and structure-activity relationships. J Med Chem51:3825-40 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GABA-C receptor
Name:GABA-C receptor
Synonyms:GABA receptor rho-1 subunit
Type:PROTEIN
Mol. Mass.:55892.34
Organism:Homo sapiens (Human)
Description:ChEMBL_1456653
Residue:479
Sequence:
MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHEDAHKQVSPI
LRRSPDITKSPLTKSEQLLRIDDHDFSMRPGFGGPAIPVGVDVQVESLDSISEVDMDFTM
TLYLRHYWKDERLSFPSTNNLSMTFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRV
QPDGKVLYSLRVTVTAMCNMDFSRFPLDTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTD
ERISLSQFLIQEFHTTTKLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSW
VSFWIDRRAVPARVPLGITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVL
EYAAVNYLTTVQERKEQKLREKLPCTSGLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKP
DRMMVQLTLASERSSPQRKSQRSSYVSMRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240386
NameBDBM50240386
Synonyms:5-amino-4-oxopentanoic acid | 5-aminolevulinic acid | AMINOLEVULINIC ACID | Aminolevulinic Acid Hydrochloride | CHEMBL601 | Levulan | delta-aminolevulinic acid
TypeSmall organic molecule
Emp. Form.C5H9NO3
Mol. Mass.131.1299
SMILESNCC(=O)CCC(O)=O
Structure
n/a