BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor
LigandBDBM50040787
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28832
Kd 1.4±n/a nM
Citation Moni, RWWillis, RJQuinn, RJ A note of caution in the use of receptor binding assays to screen marine organisms: the action of halistanol trisulphate on adenosine receptors. Bioorg Med Chem Lett2:1631-1634 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040787
NameBDBM50040787
Synonyms:CHEMBL3137809 | Sodium salt of 4,5,8-trisulphuricacid-10,13-Dimethyl-17-(1,4,5,5-tetramethyl-hexyl)-hexadecahydro-cyclopenta[a]phenanthrene
TypeSmall organic molecule
Emp. Form.C29H49Na3O12S3
Mol. Mass.754.856
SMILES[Na+].[Na+].[Na+].[H][C@@]12CCC(C(C)CCC(C)C(C)(C)C)C1(C)CC[C@@]1([H])[C@@]2([H])C[C@H](OS([O-])(=O)=O)C2C[C@H](OS([O-])(=O)=O)[C@H](CC12C)OS([O-])(=O)=O
Structure
n/a