BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-enolpyruvylshikimate-3-phosphate synthase
LigandBDBM50281349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_65093
Ki 160±n/a nM
Citation Knowles, WSAnderson, KSAndrew, SSPhillion, DPReam, JEJohnson, KASikorski, JA Synthesis & characterization of N-amino-glyphosate as a potent analog inhibitor of E. coli EPSP synthase. Bioorg Med Chem Lett3:2863-2868 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
5-enolpyruvylshikimate-3-phosphate synthase
Name:5-enolpyruvylshikimate-3-phosphate synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:46089.22
Organism:Escherichia coli (strain K12)
Description:ChEMBL_65087
Residue:427
Sequence:
MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHGKTVLTNLLDSDDVRHMLNALTAL
GVSYTLSADRTRCEIIGNGGPLHAEGALELFLGNAGTAMRPLAAALCLGSNDIVLTGEPR
MKERPIGHLVDALRLGGAKITYLEQENYPPLRLQGGFTGGNVDVDGSVSSQFLTALLMTA
PLAPEDTVIRIKGDLVSKPYIDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPGTYLVE
GDASSASYFLAAAAIKGGTVKVTGIGRNSMQGDIRFADVLEKMGATICWGDDYISCTRGE
LNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
EGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL
ARISQAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281349
NameBDBM50281349
Synonyms:CHEMBL95764 | N-(phosphonomethyl)glycine | glyphosate
TypeSmall organic molecule
Emp. Form.C3H8NO5P
Mol. Mass.169.0731
SMILESOC(=O)CNCP(O)(O)=O
Structure
n/a