Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlyceraldehyde-3-phosphate dehydrogenase
LigandBDBM50320387
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634076
IC50 620000±n/a nM
Citation Ngantchou, INyasse, BDenier, CBlonski, CHannaert, VSchneider, B Antitrypanosomal alkaloids from Polyalthia suaveolens (Annonaceae): their effects on three selected glycolytic enzymes of Trypanosoma brucei. Bioorg Med Chem Lett20:3495-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glyceraldehyde-3-phosphate dehydrogenase
Name:Glyceraldehyde-3-phosphate dehydrogenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35788.14
Organism:Oryctolagus cuniculus
Description:ChEMBL_980137
Residue:333
Sequence:
MVKVGVNGFGRIGRLVTRAAFNSGKVDVVAINDPFIDLHYMVYMFQYDSTHGKFHGTVKA
ENGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIIS
APSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSATHSSTFDAGAGIA
LNDHFVKLISWYDNEFGYSNRVVDLMVHMASKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50320387
NameBDBM50320387
Synonyms:CHEMBL1086376 | polyveoline
TypeSmall organic molecule
Emp. Form.C23H33NO
Mol. Mass.339.5142
SMILESC[C@@]12CC[C@H]3C(C)(C)[C@H](O)CC[C@]3(C)[C@@H]1C[C@@H]1Nc3ccccc3[C@H]21 |r|
Structure
n/a