Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFructose-bisphosphate aldolase A
LigandBDBM50320386
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634088
IC50 150000±n/a nM
Citation Ngantchou, INyasse, BDenier, CBlonski, CHannaert, VSchneider, B Antitrypanosomal alkaloids from Polyalthia suaveolens (Annonaceae): their effects on three selected glycolytic enzymes of Trypanosoma brucei. Bioorg Med Chem Lett20:3495-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fructose-bisphosphate aldolase A
Name:Fructose-bisphosphate aldolase A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39351.00
Organism:Oryctolagus cuniculus
Description:ChEMBL_813854
Residue:364
Sequence:
MPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFIS
NHAY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50320386
NameBDBM50320386
Synonyms:3-O-acetylgreenwayodendrin | CHEMBL1083629
TypeSmall organic molecule
Emp. Form.C25H33NO2
Mol. Mass.379.535
SMILESCC(=O)O[C@H]1CC[C@]2(C)[C@H]3Cc4cc5ccccc5n4[C@]3(C)CC[C@H]2C1(C)C |r|
Structure
n/a