Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein phosphatase non-receptor type 1
LigandBDBM50152579
Substrate/Competitorn/a
Meas. Tech.ChEMBL_743505
IC50 20000±n/a nM
Citation Vintonyak, VVWaldmann, HRauh, D Using small molecules to target protein phosphatases. Bioorg Med Chem19:2145-55 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein phosphatase non-receptor type 1
Name:Tyrosine-protein phosphatase non-receptor type 1
Synonyms:PTP1B | Protein tyrosine phosphatase 1B (PTP1B) | Protein tyrosine phosphatase-1B (PTP1B) | Protein-tyrosine phosphatase 1B | Protein-tyrosine phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase non-receptor type 1 | Tyrosine-protein phosphatase non-receptor type 1 (PTP1B)
Type:Protein phosphatase
Mol. Mass.:49963.76
Organism:Homo sapiens (Human)
Description:Human recombinant GST-fusion PTP1B (1-435).
Residue:435
Sequence:
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50152579
NameBDBM50152579
Synonyms:4-(2-Fluoro-phenyl)-2,4-dioxo-butyric acid | CHEMBL364328 | Sacchettini_2
TypeSmall organic molecule
Emp. Form.C10H7FO4
Mol. Mass.210.1586
SMILESOC(=O)C(=O)CC(=O)c1ccccc1F
Structure
n/a