BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSqualene synthetase
LigandBDBM50290882
Substrate/Competitorn/a
Meas. Tech.ChEMBL_202120
IC50 950±n/a nM
Citation Wattanasin, SBoettcher, BRScallen, T N-Hydroxyglycine derivatives as novel inhibitors of squalene synthase Bioorg Med Chem Lett7:3039-3044 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Squalene synthetase
Name:Squalene synthetase
Synonyms:FPP:FPP farnesyltransferase | Farnesyl-diphosphate farnesyltransferase | SQS | SS
Type:PROTEIN
Mol. Mass.:48109.41
Organism:Rattus norvegicus
Description:ChEMBL_1336736
Residue:416
Sequence:
MEFVKCLGHPEEFYNLLRFRMGGRRNFIPKMDRNSLSNSLKTCYKYLDQTSRSFAAVIQA
LDGDIRHAVCVFYLILRAMDTVEDDMAISVEKKIPLLRNFHTFLYEPEWRFTESKEKHRV
VLEDFPTISLEFRNLAEKYQTVIADICHRMGCGMAEFLNKDVTSKQDWDKYCHYVAGLVG
IGLSRLFSASEFEDPIVGEDTECANSMGLFLQKTNIIRDYLEDQQEGRQFWPQEVWGKYV
KKLEDFVKPENVDVAVKCLNELITNALQHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL
AACYNNHQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRVPNSDPSASKAK
QLISNIRTQSLPNCQLISRSHYSPIYLSFIMLLAALSWQYLSTLSQVTEDYVQREH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290882
NameBDBM50290882
Synonyms:CHEMBL102521 | N-hydroxyglycine derivative
TypeSmall organic molecule
Emp. Form.C22H31N2O5
Mol. Mass.403.4925
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#8]-c1cccc(-[#6]-[#7]-[#6](=O)-[#7](-[#8])C([#6])([#6])[#6](-[#8-])=O)c1
Structure
n/a