Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1-acid glycoprotein 1
LigandBDBM50111451
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32972
IC50 5000000±n/a nM
Citation Kaila, NChen, LThomas, BETsao, DTam, SBedard, PWCamphausen, RTAlvarez, JCUllas, G Beta-C-mannosides as selectin inhibitors. J Med Chem45:1563-6 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1-acid glycoprotein 1
Name:Alpha-1-acid glycoprotein 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:23503.71
Organism:Homo sapiens (Human)
Description:ChEMBL_32972
Residue:201
Sequence:
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
DKCEPLEKQHEKERKQEEGES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111451
NameBDBM50111451
Synonyms:2-[2-(3,4,5-Trihydroxy-6-{[2-(1-phenyl-ethylcarbamoyl)-benzoylamino]-methyl}-tetrahydro-pyran-2-yl)-acetylamino]-pentanedioic acid | CHEMBL288811
TypeSmall organic molecule
Emp. Form.C29H35N3O11
Mol. Mass.601.6017
SMILESC[C@@H](NC(=O)c1ccccc1C(=O)NCC1OC(CC(=O)N[C@@H](CCC(O)=O)C(O)=O)C(O)C(O)C1O)c1ccccc1
Structure
n/a