Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1-acid glycoprotein 1
LigandBDBM50111453
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32972
IC50 8000000±n/a nM
Citation Kaila, NChen, LThomas, BETsao, DTam, SBedard, PWCamphausen, RTAlvarez, JCUllas, G Beta-C-mannosides as selectin inhibitors. J Med Chem45:1563-6 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1-acid glycoprotein 1
Name:Alpha-1-acid glycoprotein 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:23503.71
Organism:Homo sapiens (Human)
Description:ChEMBL_32972
Residue:201
Sequence:
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
DKCEPLEKQHEKERKQEEGES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111453
NameBDBM50111453
Synonyms:(4R,5S)-2-{[(3S,4S,5S)-2-{[(2S,3S)-5-acetamido-6-hydroxy-2-(hydroxymethyl)-4-{[(2S,6S)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxy}oxan-3-yl]oxy}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy}-4-hydroxy-5-[({2-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]acetamido}carbonyl)amino]-6-[(1R,2R)-1,2,3-trihydroxypropyl]oxane-2-carboxylate | Beta-C-Mannoside derivative(sLex)
TypeSmall organic molecule
Emp. Form.C38H62N3O29
Mol. Mass.1024.9021
SMILESC[C@@H]1O[C@@H](OC2C(NC(C)=O)C(O)O[C@@H](CO)[C@H]2OC2OC(CO)[C@H](O)[C@H](OC3(C[C@@H](O)[C@H](NC(=O)NC(=O)CC4OC(CO)C(O)C(O)C4O)C(O3)[C@H](O)[C@H](O)CO)C([O-])=O)[C@@H]2O)C(O)C(O)C1O
Structure
n/a