Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOligopeptide transporter small intestine isoform
LigandBDBM50240386
Substrate/Competitorn/a
Meas. Tech.ChEMBL_89213
Ki 790000±n/a nM
Citation Gebauer, SKnütter, IHartrodt, BBrandsch, MNeubert, KThondorf, I Three-dimensional quantitative structure-activity relationship analyses of peptide substrates of the mammalian H+/peptide cotransporter PEPT1. J Med Chem46:5725-34 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oligopeptide transporter small intestine isoform
Name:Oligopeptide transporter small intestine isoform
Synonyms:Intestinal H(+)/peptide cotransporter | Oligopeptide transporter, small intestine isoform | Peptide transporter 1
Type:PROTEIN
Mol. Mass.:78818.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1488839
Residue:708
Sequence:
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240386
NameBDBM50240386
Synonyms:5-amino-4-oxopentanoic acid | 5-aminolevulinic acid | AMINOLEVULINIC ACID | Aminolevulinic Acid Hydrochloride | CHEMBL601 | Levulan | delta-aminolevulinic acid
TypeSmall organic molecule
Emp. Form.C5H9NO3
Mol. Mass.131.1299
SMILESNCC(=O)CCC(O)=O
Structure
n/a