Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylosuccinate synthetase 2
LigandBDBM50149229
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29913
IC50 43±n/a nM
Citation Erlanson, DAMcDowell, RSO'Brien, T Fragment-based drug discovery. J Med Chem47:3463-82 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenylosuccinate synthetase 2
Name:Adenylosuccinate synthetase 2
Synonyms:AMPSase 2 | AdSS 2 | Adenylosuccinate synthetase isozyme 2 | Adenylosuccinate synthetase, acidic isozyme | IMP--aspartate ligase 2
Type:PROTEIN
Mol. Mass.:50096.76
Organism:Homo sapiens (Human)
Description:ChEMBL_29913
Residue:456
Sequence:
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50149229
NameBDBM50149229
Synonyms:5-((1R,5S,7R,8S,9R)-8,9-Dihydroxy-2,4-dioxo-7-phosphonooxymethyl-6-oxa-1,3-diaza-spiro[4.4]non-3-yl)-2-((S)-formyl-hydroxy-amino)-pentanoic acid | CHEMBL118357
TypeSmall organic molecule
Emp. Form.C13H20N3O13P
Mol. Mass.457.284
SMILESO[C@@H]1[C@@H](COP(O)(O)=O)O[C@@]2(NC(=O)N(CCC[C@H](N(O)C=O)C(O)=O)C2=O)[C@@H]1O
Structure
n/a