Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-arginine N-methyltransferase 1
LigandBDBM50210461
Substrate/Competitorn/a
Meas. Tech.ChEMBL_434655
IC50 56900±n/a nM
Citation Spannhoff, AHeinke, RBauer, ITrojer, PMetzger, EGust, RSchüle, RBrosch, GSippl, WJung, M Target-based approach to inhibitors of histone arginine methyltransferases. J Med Chem50:2319-25 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-arginine N-methyltransferase 1
Name:Protein-arginine N-methyltransferase 1
Synonyms:Protein arginine N-methyltransferase 1 (PRMT1) | Protein arginine methyltransferase 1 (PRMT1)
Type:Protein
Mol. Mass.:41506.52
Organism:Homo sapiens (Human)
Description:n/a
Residue:361
Sequence:
MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIV
KANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGL
IFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNAC
LIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYT
HWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRM
R
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50210461
NameBDBM50210461
Synonyms:(stilbamidine)4-[2-[4-amino(imino)methylphenyl]-(E)-1-ethenyl]phenyl-iminomethanamine | 4,4'-(ethene-1,2-diyl)dibenzimidamide | 4-((E)-2-{4-[(Z)-amino(imino)methyl]phenyl}vinyl)benzenecarboximidamide | 4-((E)-2-{4-[(Z)-amino(imino)methyl]phenyl}vinyl)benzenecarboximidamide(stilbamidine isethionate) | CHEMBL142304 | NSC-35605 | stilbamidine
TypeSmall organic molecule
Emp. Form.C16H16N4
Mol. Mass.264.325
SMILESNC(=N)c1ccc(\C=C\c2ccc(cc2)C(N)=N)cc1
Structure
n/a