Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic Alpha
LigandBDBM50377964
Substrate/Competitorn/a
Meas. Tech.ChEMBL_534654
IC50 64900±n/a nM
Citation Ahlin, GKarlsson, JPedersen, JMGustavsson, LLarsson, RMatsson, PNorinder, UBergström, CAArtursson, P Structural requirements for drug inhibition of the liver specific human organic cation transport protein 1. J Med Chem51:5932-42 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adrenergic Alpha
Name:Solute carrier family 22 member 1
Synonyms:Organic cation transporter 1 | Solute carrier family 22 member 1 | hOCT1
Type:Enzyme Catalytic Domain
Mol. Mass.:61154.85
Organism:Homo sapiens (Human)
Description:Adrenergic Alpha 0 HUMAN::O15245
Residue:554
Sequence:
MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLKVQTSEPSGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50377964
NameBDBM50377964
Synonyms:Cantil | Glycophenylate | MEPENZOLATE BROMIDE | Mepenzolate
TypeSmall organic molecule
Emp. Form.C21H26NO3
Mol. Mass.340.4355
SMILESC[N+]1(C)CCCC(C1)OC(=O)C(O)(c1ccccc1)c1ccccc1
Structure
n/a