Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDehydrosqualene synthase
LigandBDBM50388906
Substrate/Competitorn/a
Meas. Tech.ChEMBL_830995
IC50 33000±n/a nM
Citation Zhang, YFu-Yang, LinLi, KZhu, WLiu, YLCao, RPang, RLee, EAxelson, JHensler, MWang, KMolohon, KJWang, YMitchell, DANizet, VOldfield, E HIV-1 Integrase Inhibitor-Inspired Antibacterials Targeting Isoprenoid Biosynthesis. ACS Med Chem Lett3:402-406 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dehydrosqualene synthase
Name:Dehydrosqualene synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:34309.10
Organism:Staphylococcus aureus
Description:ChEMBL_1352846
Residue:287
Sequence:
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
NQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENE
RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPI
IELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKYHRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50388906
NameBDBM50388906
Synonyms:CHEMBL2063256
TypeSmall organic molecule
Emp. Form.C19H23NO5
Mol. Mass.345.3896
SMILESCCCCCCOc1cccc(Cn2ccc(O)c(C(O)=O)c2=O)c1
Structure
n/a