Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier family 22 member 6
LigandBDBM50370587
Substrate/Competitorn/a
Meas. Tech.ChEMBL_835925
Ki 450000±n/a nM
Citation Jariyawat, SSekine, TTakeda, MApiwattanakul, NKanai, YSophasan, SEndou, H The interaction and transport of beta-lactam antibiotics with the cloned rat renal organic anion transporter 1. J Pharmacol Exp Ther290:672-7 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Solute carrier family 22 member 6
Name:Solute carrier family 22 member 6
Synonyms:Organic anion transporter 1 | rOAT1 | rROAT1 | renal organic anion transporter 1
Type:PROTEIN
Mol. Mass.:60784.17
Organism:Rattus norvegicus
Description:ChEMBL_838479
Residue:551
Sequence:
MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIPPHHCRPPANANLSKD
GGLEAWLPLDKQGQPESCLRFTSPQWGPPFYNGTEANGTRVTEPCIDGWVYDNSTFPSTI
VTEWNLVCSHRAFRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
YAPNYTVYCVFRLLSGMSLASIAINCMTLNVEWMPIHTRAYVGTLIGYVYSLGQFLLAGI
AYAVPHWRHLQLVVSVPFFIAFIYSWFFIESARWYSSSGRLDLTLRALQRVARINGKQEE
GAKLSIEVLRTSLQKELTLSKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQMASLLLAGICILVNGIIPKSHT
IIRTSLAVLGKGCLASSFNCIFLYTGELYPTVIRQTGLGMGSTMARVGSIVSPLVSMTAE
FYPSMPLFIFGAVPVVASAVTALLPETLGQPLPDTVQDLKSRSRGKQNQQQQEQQKQMMP
LQASTQEKNGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50370587
NameBDBM50370587
Synonyms:CEFAZOLIN
TypeSmall organic molecule
Emp. Form.C14H14N8O4S3
Mol. Mass.454.507
SMILESCc1nnc(SCC2=C(N3[C@H](SC2)[C@H](NC(=O)Cn2cnnn2)C3=O)C(O)=O)s1 |r,t:7|
Structure
n/a