Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase placental-like
LigandBDBM50404862
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29964
IC50>16000000±n/a nM
Citation Schwender, CFSunday, BRDecker, VL Alkaline phosphatase inhibition by a series of pyrido[2,1-b]quinazolines: A possible relationship with cromolyn-like antiallergy activity. J Med Chem25:742-5 (1982) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alkaline phosphatase placental-like
Name:Alkaline phosphatase placental-like
Synonyms:placental-like alkaline phosphatase preproprotein
Type:PROTEIN
Mol. Mass.:57374.31
Organism:Homo sapiens (Human)
Description:ChEMBL_29964
Residue:532
Sequence:
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50404862
NameBDBM50404862
Synonyms:CROMOLYN SODIUM | Crolom | Cromoglicic Acid | Cromoglycic Acid | Cromolyn
TypeSmall organic molecule
Emp. Form.C23H14O11
Mol. Mass.466.3518
SMILESOC(COc1cccc2oc(cc(=O)c12)C([O-])=O)COc1cccc2oc(cc(=O)c12)C([O-])=O
Structure
n/a