Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLaforin
LigandBDBM50425806
Substrate/Competitorn/a
Meas. Tech.ChEMBL_937595
IC50 31000±n/a nM
Citation He, YXu, JYu, ZHGunawan, AMWu, LWang, LZhang, ZY Discovery and evaluation of novel inhibitors of mycobacterium protein tyrosine phosphatase B from the 6-Hydroxy-benzofuran-5-carboxylic acid scaffold. J Med Chem56:832-42 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Laforin
Name:Laforin
Synonyms:EPM2A | LAFPTPase | Lafora PTPase | Laforin
Type:Protein
Mol. Mass.:37158.16
Organism:Homo sapiens (Human)
Description:O95278
Residue:331
Sequence:
MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGDGALALQEPGLW
LGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDG
VYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKL
KHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEG
RVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKR
PAVYIDEEALARAQEDFFQKFGKVRSSVCSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50425806
NameBDBM50425806
Synonyms:CHEMBL2316907
TypeSmall organic molecule
Emp. Form.C24H13F3O5
Mol. Mass.438.3522
SMILESOC(=O)c1cc2c(C#Cc3ccc(OC(F)(F)F)cc3)c(oc2cc1O)-c1ccccc1
Structure
n/a