Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-14 (MMP14)
LigandBDBM50431942
Substrate/Competitorn/a
Meas. Tech.ChEMBL_953676
IC50>30000±n/a nM
Citation Atobe, MMaekawara, NIshiguro, NSogame, SSuenaga, YKawanishi, MSuzuki, HJinno, NTanaka, EMiyoshi, S A series of thiazole derivatives bearing thiazolidin-4-one as non-competitive ADAMTS-5 (aggrecanase-2) inhibitors. Bioorg Med Chem Lett23:2106-10 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-14 (MMP14)
Name:Matrix metalloproteinase 14
Synonyms:MMP-14 | MMP-X1 | MT-MMP 1 | MT1-MMP | MT1MMP | MTMMP1 | Matrix Metalloproteinase-14 (MMP-14) | Matrix metalloproteinase 14 | Matrix metalloproteinase-14 | Membrane-type matrix metalloproteinase 1 | Membrane-type-1 matrix metalloproteinase
Type:Protein
Mol. Mass.:65900.19
Organism:Homo sapiens (Human)
Description:P50281
Residue:582
Sequence:
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431942
NameBDBM50431942
Synonyms:CHEMBL2347847
TypeSmall organic molecule
Emp. Form.C15H12N2O3S2
Mol. Mass.332.397
SMILESOC(=O)Cc1sc(\C=C2/NC(=O)CS2)nc1-c1ccccc1
Structure
n/a