Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLethal(3)malignant brain tumor-like protein 3 (L3MBTL3)
LigandBDBM50440579
Substrate/Competitorn/a
Meas. Tech.ChEMBL_983410
IC50 620±n/a nM
Citation James, LIKorboukh, VKKrichevsky, LBaughman, BMHerold, JMNorris, JLJin, JKireev, DBJanzen, WPArrowsmith, CHFrye, SV Small-molecule ligands of methyl-lysine binding proteins: optimization of selectivity for L3MBTL3. J Med Chem56:7358-71 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lethal(3)malignant brain tumor-like protein 3 (L3MBTL3)
Name:Lethal(3)malignant brain tumor-like protein 3 (L3MBTL3)
Synonyms:H-l(3)mbt-like protein 3 | L(3)mbt-like protein 3 | Lethal(3)malignant brain tumor-like protein 3 | MBT-1
Type:Protein
Mol. Mass.:88334.17
Organism:Homo sapiens (Human)
Description:n/a
Residue:780
Sequence:
MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATA
TTTWMVPTAQEAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFC
ENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLK
ADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPPKGKKAWCWASYLEE
EKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDG
YSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFE
NQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASS
PHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMK
LEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPL
QPPLSPLELMEASEHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRL
SGEMPPASPSFPRNKRTDANESSSSPEIRDQHADDVKEDFEERTESEMRTSHEARGAREE
PTVQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVAGIPASKVSKWSTDEVSEFIQSL
PGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNSHNEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50440579
NameBDBM50440579
Synonyms:CHEMBL2426466
TypeSmall organic molecule
Emp. Form.C25H36N4O2
Mol. Mass.424.5789
SMILESO=C(N1CCC(CC1)N1CCCC1)c1ccc(cc1)C(=O)N1CCC2(CCNC2)CC1
Structure
n/a