Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-hydroxyanthranilate 3,4-dioxygenase
LigandBDBM50446510
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1287917
IC50 1100±n/a nM
Citation Vallerini, GPAmori, LBeato, CTararina, MWang, XDSchwarcz, RCostantino, G 2-Aminonicotinic acid 1-oxides are chemically stable inhibitors of quinolinic acid synthesis in the mammalian brain: a step toward new antiexcitotoxic agents. J Med Chem56:9482-95 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-hydroxyanthranilate 3,4-dioxygenase
Name:3-hydroxyanthranilate 3,4-dioxygenase
Synonyms:3-HAO | 3-hydroxyanthranilate oxygenase | 3-hydroxyanthranilic acid dioxygenase | HAAO | HAD
Type:PROTEIN
Mol. Mass.:32552.73
Organism:Homo sapiens (Human)
Description:ChEMBL_108017
Residue:286
Sequence:
MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEG
DMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYV
GDTMDVLFEKWFYCKDLGTQLAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEP
MSLDAWLDSHHRELQAGTPLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVT
MGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446510
NameBDBM50446510
Synonyms:CHEMBL3110069
TypeSmall organic molecule
Emp. Form.C7H8N2O3
Mol. Mass.168.15
SMILESCc1ccc(C(O)=O)c(N)[n+]1[O-]
Structure
n/a