Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-arginine methyltransferase CARM1
LigandBDBM50210461
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1334937
IC50 400000±n/a nM
Citation Yan, LYan, CQian, KSu, HKofsky-Wofford, SALee, WCZhao, XHo, MCIvanov, IZheng, YG Diamidine compounds for selective inhibition of protein arginine methyltransferase 1. J Med Chem57:2611-22 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-arginine methyltransferase CARM1
Name:Histone-arginine methyltransferase CARM1
Synonyms:CARM1 | Coactivator-associated arginine methyltransferase 1 | Coactivator-associated arginine methyltransferase 1 (CARM1) | Protein arginine N-methyltransferase 4 | Protein arginine methyltransferase 4 (PRMT4)
Type:Protein
Mol. Mass.:65855.47
Organism:Homo sapiens (Human)
Description:Q86X55
Residue:608
Sequence:
MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEV
RAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSF
YNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNH
TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPG
KVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDE
QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFL
EAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTT
PSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLAN
TGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
TNTMHYGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50210461
NameBDBM50210461
Synonyms:(stilbamidine)4-[2-[4-amino(imino)methylphenyl]-(E)-1-ethenyl]phenyl-iminomethanamine | 4,4'-(ethene-1,2-diyl)dibenzimidamide | 4-((E)-2-{4-[(Z)-amino(imino)methyl]phenyl}vinyl)benzenecarboximidamide | 4-((E)-2-{4-[(Z)-amino(imino)methyl]phenyl}vinyl)benzenecarboximidamide(stilbamidine isethionate) | CHEMBL142304 | NSC-35605 | stilbamidine
TypeSmall organic molecule
Emp. Form.C16H16N4
Mol. Mass.264.325
SMILESNC(=N)c1ccc(\C=C\c2ccc(cc2)C(N)=N)cc1
Structure
n/a