Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSqualene synthetase
LigandBDBM50357696
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1336736
IC50 12800±n/a nM
Citation Matralis, ANKourounakis, AP Design of novel potent antihyperlipidemic agents with antioxidant/anti-inflammatory properties: exploiting phenothiazine's strong antioxidant activity. J Med Chem57:2568-81 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Squalene synthetase
Name:Squalene synthetase
Synonyms:FPP:FPP farnesyltransferase | Farnesyl-diphosphate farnesyltransferase | SQS | SS
Type:PROTEIN
Mol. Mass.:48109.41
Organism:Rattus norvegicus
Description:ChEMBL_1336736
Residue:416
Sequence:
MEFVKCLGHPEEFYNLLRFRMGGRRNFIPKMDRNSLSNSLKTCYKYLDQTSRSFAAVIQA
LDGDIRHAVCVFYLILRAMDTVEDDMAISVEKKIPLLRNFHTFLYEPEWRFTESKEKHRV
VLEDFPTISLEFRNLAEKYQTVIADICHRMGCGMAEFLNKDVTSKQDWDKYCHYVAGLVG
IGLSRLFSASEFEDPIVGEDTECANSMGLFLQKTNIIRDYLEDQQEGRQFWPQEVWGKYV
KKLEDFVKPENVDVAVKCLNELITNALQHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL
AACYNNHQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRVPNSDPSASKAK
QLISNIRTQSLPNCQLISRSHYSPIYLSFIMLLAALSWQYLSTLSQVTEDYVQREH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50357696
NameBDBM50357696
Synonyms:CHEMBL1915483
TypeSmall organic molecule
Emp. Form.C21H19NO2
Mol. Mass.317.3811
SMILESCN1CC(O)(Oc2ccccc12)c1ccc(cc1)-c1ccccc1
Structure
n/a