Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLaforin
LigandBDBM50087856
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1476067
pH7±n/a
IC50 10300±n/a nM
Commentsextracted
Citation He, YGuo, XYu, ZHWu, LGunawan, AMZhang, YDixon, JEZhang, ZY A potent and selective inhibitor for the UBLCP1 proteasome phosphatase. Bioorg Med Chem23:2798-809 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Laforin
Name:Laforin
Synonyms:EPM2A | LAFPTPase | Lafora PTPase | Laforin
Type:Protein
Mol. Mass.:37158.16
Organism:Homo sapiens (Human)
Description:O95278
Residue:331
Sequence:
MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGDGALALQEPGLW
LGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDG
VYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKL
KHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEG
RVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKR
PAVYIDEEALARAQEDFFQKFGKVRSSVCSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087856
NameBDBM50087856
Synonyms:CHEMBL3426913
TypeSmall organic molecule
Emp. Form.C28H30F3NO6
Mol. Mass.533.5361
SMILESCCCCC(Oc1cc(O)c(cc1C#Cc1ccccc1OC(F)(F)F)C(O)=O)C(=O)NC1CCCCC1
Structure
n/a