Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTissue non-specific alkaline phosphatase (TNAP)
LigandBDBM50165137
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1572751
Ki 2280±n/a nM
Citation al-Rashida, MBatool, GSattar, AEjaz, SAKhan, SLecka, JSévigny, JHameed, AIqbal, J 2-Alkoxy-3-(sulfonylarylaminomethylene)-chroman-4-ones as potent and selective inhibitors of ectonucleotidases. Eur J Med Chem115:484-94 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tissue non-specific alkaline phosphatase (TNAP)
Name:Tissue non-specific alkaline phosphatase (TNAP)
Synonyms:ALPL | AP-TNAP | Alkaline phosphatase liver/bone/kidney isozyme | Alkaline phosphatase, tissue-nonspecific isozyme | TNSALP
Type:Protein
Mol. Mass.:57195.60
Organism:Bos taurus (Cattle)
Description:P09487
Residue:524
Sequence:
MISPFLLLAIGTCFASSLVPEKEKDPKYWRDQAQQTLKNALRLQTLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHSPGEETKLEMDKFPYVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATQRSQCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSASYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIEVIMGGGRKYMFPKNRTDVEYELDE
KARGTRLDGLNLIDIWKSFKPKHKHSHYVWNRTDLLALDPHSVDYLLGLFEPGDMQYELN
RNNATDPSLSEMVEMAIRILNKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIG
QAGAMTSVEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYAACIGANRDHCASASSSGSPSPGPLLLLLALLPLGSLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50165137
NameBDBM50165137
Synonyms:CHEMBL3800324
TypeSmall organic molecule
Emp. Form.C17H14Cl2N2O5S
Mol. Mass.429.274
SMILESCOC1Oc2c(Cl)cc(Cl)cc2C(=O)\C1=C/Nc1ccccc1S(N)(=O)=O
Structure
n/a