Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcto-5'-nucleotidase (e5'NT)
LigandBDBM50165137
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1572756
Ki 87±n/a nM
Citation al-Rashida, MBatool, GSattar, AEjaz, SAKhan, SLecka, JSévigny, JHameed, AIqbal, J 2-Alkoxy-3-(sulfonylarylaminomethylene)-chroman-4-ones as potent and selective inhibitors of ectonucleotidases. Eur J Med Chem115:484-94 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ecto-5'-nucleotidase (e5'NT)
Name:Ecto-5'-nucleotidase (e5'NT)
Synonyms:5'-nucleotidase | Ecto-5-nucleotidase (e5'NT) | NT
Type:Enzyme
Mol. Mass.:63971.44
Organism:Rattus norvegicus (Rat)
Description:P21588
Residue:576
Sequence:
MRPAAATAPKWLLLALSALLPLWPTAKSWELTIMHTNDVHSRLEQTSDDSTKCLNASLCV
GGVARLFTKVQQIRKEEPNVLLLDAGDQYQGTIWFTVYKGLEVAHFMNLLGYDAMALGNH
EFDNGVEGLIDPLLRNVKFPILSANIKARGPLAPQISGLYLPYKVLSVGGEVVGIVGYTS
KETPFLSNPGTNLVFEDEVTALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDV
VVGGHTNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVEFDDKG
NVVTSYGNPILLNSTIREDAAIKADINQWRIKLDNYSTQELGRTIVYLNGSAQECRFREC
NMGNLICDAMINNNLRHPDEMFWNHVSMCIVNGGGIRSPIDERNNGTITWENLAAVLPFG
GTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDISRKPWDRVVQLKVLCTK
CRVPIYEPLEMDKVYKVVLPSYLVNGGDGFQMIKDELLKHDSGDQDISVVSEYISKMKVI
YPAVEGRIKFSAASHYQGSFPLIILSFWAVILVLYQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50165137
NameBDBM50165137
Synonyms:CHEMBL3800324
TypeSmall organic molecule
Emp. Form.C17H14Cl2N2O5S
Mol. Mass.429.274
SMILESCOC1Oc2c(Cl)cc(Cl)cc2C(=O)\C1=C/Nc1ccccc1S(N)(=O)=O
Structure
n/a