Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosyl-DNA phosphodiesterase 1
LigandBDBM50179183
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1582565
IC50>111000±n/a nM
Citation Kossmann, BRAbdelmalak, MLopez, STender, GYan, CPommier, YMarchand, CIvanov, I Discovery of selective inhibitors of tyrosyl-DNA phosphodiesterase 2 by targeting the enzyme DNA-binding cleft. Bioorg Med Chem Lett26:3232-3236 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosyl-DNA phosphodiesterase 1
Name:Tyrosyl-DNA phosphodiesterase 1
Synonyms:Tyrosyl-DNA phosphodiesterase 1
Type:Enzyme
Mol. Mass.:68430.66
Organism:Homo sapiens (Human)
Description:Q9NUW8
Residue:608
Sequence:
MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKI
SPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPN
DGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNS
GALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHA
QAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSP
LYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPG
RFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESM
LTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKW
SAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELG
VLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDT
HGNMWVPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179183
NameBDBM50179183
Synonyms:CHEMBL576840 | NSC-3198
TypeSmall organic molecule
Emp. Form.C22H24N2O6S2
Mol. Mass.476.566
SMILESOC(=O)C(CSSCC(NC(=O)Cc1ccccc1)C(O)=O)NC(=O)Cc1ccccc1
Structure
n/a