Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosyl-DNA phosphodiesterase 2
LigandBDBM50179184
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1582564
IC50 15000±n/a nM
Citation Kossmann, BRAbdelmalak, MLopez, STender, GYan, CPommier, YMarchand, CIvanov, I Discovery of selective inhibitors of tyrosyl-DNA phosphodiesterase 2 by targeting the enzyme DNA-binding cleft. Bioorg Med Chem Lett26:3232-3236 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosyl-DNA phosphodiesterase 2
Name:Tyrosyl-DNA phosphodiesterase 2
Synonyms:5''-Tyr-DNA phosphodiesterase | 5''-tyrosyl-DNA phosphodiesterase | TRAF and TNF receptor-associated protein homolog | Tyr-DNA phosphodiesterase 2 | Tyrosyl-DNA phosphodiesterase 2 | si:dkey-218n20.5 | tdp2 | ttrap | ttrapl
Type:PROTEIN
Mol. Mass.:41494.89
Organism:Danio rerio
Description:ChEMBL_116802
Residue:369
Sequence:
MSALGESRTRLCDQFAFVSGSDSAVAQCYLAENEWDMERALNSFFEAHMDSVFDEEAEKT
EVTGNKRKDDTAEASGTKKKLKTDNADCIDLTAEEPTCSITVNSKENQAENGTAKSEVED
SKLSIISWNVDGLDTLNLADRARGLCSYLALYTPDVVFLQELIPAYVQYLKKRAVSYLFF
EGSDDGYFTGIMLRKSRVKFLESEIICFPTTQMMRNLLIAQVTFSGQKLYLMTSHLESCK
NQSQERTKQLRVVLQKIKEAPEDAIVIFAGDTNLRDAEVANVGGLPAGVCDVWEQLGKQE
HCRYTWDTKANSNKTVPYVSRCRFDRIFLRSAKTAPPVTPDHMALIGMEKLDCGRYTSDH
WGIYCTFNT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179184
NameBDBM50179184
Synonyms:CHEMBL264425
TypeSmall organic molecule
Emp. Form.C20H20N2O6S2
Mol. Mass.448.513
SMILESOC(=O)C(CSSCC(NC(=O)c1ccccc1)C(O)=O)NC(=O)c1ccccc1
Structure
n/a