Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase catalytic subunit alpha-1/beta-1/gamma-1
LigandBDBM237920
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1612927
EC50 7.0±n/a nM
Citation Cameron, KOKung, DWKalgutkar, ASKurumbail, RGMiller, RSalatto, CTWard, JWithka, JMBhattacharya, SKBoehm, MBorzilleri, KABrown, JACalabrese, MCaspers, NLCokorinos, EConn, ELDowling, MSEdmonds, DJEng, HFernando, DPFrisbie, RHepworth, DLandro, JMao, YRajamohan, FReyes, ARRose, CRRyder, TShavnya, ASmith, ACTu, MWolford, ACXiao, J Discovery and Preclinical Characterization of 6-Chloro-5-[4-(1-hydroxycyclobutyl)phenyl]-1H-indole-3-carboxylic Acid (PF-06409577), a Direct Activator of Adenosine Monophosphate-activated Protein Kinase (AMPK), for the Potential Treatment of Diabetic Nephropathy. J Med Chem59:8068-81 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase catalytic subunit alpha-1/beta-1/gamma-1
Name:5'-AMP-activated protein kinase catalytic subunit alpha-1/beta-1/gamma-1
Synonyms:5''-AMP-activated protein kinase subunit gamma-1 | AMPK gamma1 | AMPK subunit gamma-1 | AMPKg | Prkag1
Type:PROTEIN
Mol. Mass.:37388.74
Organism:Rattus norvegicus
Description:ChEMBL_117047
Residue:330
Sequence:
MESVAAESAPAPENEHSQETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAF
FALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY
LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIY
SKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLV
VVDEHDVVKGIVSLSDILQALVLTGGEKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM237920
NameBDBM237920
Synonyms:US9394285, 1
TypeSmall organic molecule
Emp. Form.C19H16ClNO3
Mol. Mass.341.788
SMILESOC(=O)c1c[nH]c2cc(Cl)c(cc12)-c1ccc(cc1)C1(O)CCC1
Structure
n/a