Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoacylglycerol lipase ABHD6
LigandBDBM50211271
Substrate/Competitorn/a
Meas. Tech.ChEBML_1636269
IC50 50±n/a nM
Citation Deng, HKooijman, Svan den Nieuwendijk, AMOgasawara, Dvan der Wel, Tvan Dalen, FBaggelaar, MPJanssen, FJvan den Berg, RJden Dulk, HCravatt, BFOverkleeft, HSRensen, PCvan der Stelt, M Triazole Ureas Act as Diacylglycerol Lipase Inhibitors and Prevent Fasting-Induced Refeeding. J Med Chem60:428-440 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoacylglycerol lipase ABHD6
Name:Monoacylglycerol lipase ABHD6
Synonyms:2-arachidonoylglycerol hydrolase | ABHD6 | Abhydrolase domain-containing protein 6 | Monoacylglycerol lipase ABHD6
Type:PROTEIN
Mol. Mass.:38341.83
Organism:Homo sapiens (Human)
Description:ChEMBL_105457
Residue:337
Sequence:
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211271
NameBDBM50211271
Synonyms:CHEMBL3913807
TypeSmall organic molecule
Emp. Form.C29H28F2N4O3
Mol. Mass.518.5544
SMILESCO[C@@H]1CC[C@H](Cc2ccccc2)N(C1)C(=O)n1ncc(n1)C(O)(c1ccc(F)cc1)c1ccc(F)cc1 |r|
Structure
n/a