Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKHEYLRF-NH2 (AF2)
LigandBDBM86059
Substrate/Competitorn/a
Ki 10.5±n/a nM
CommentsPDSP_2615
Citation Kubiak, TMLarsen, MJDavis, JPZantello, MRBowman, JW AF2 interaction with Ascaris suum body wall muscle membranes involves G-protein activation. Biochem Biophys Res Commun301:456-9 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
KHEYLRF-NH2 (AF2)
Name:KHEYLRF-NH2 (AF2)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:15899.01
Organism:Ascaris
Description:KHEYLRF-NH2 (AF2) 0 Ascaris::Q9XWV7
Residue:143
Sequence:
MMICLPTALLLSAFVVAASGQEAPAGAGASGAAQAPHNPKDCQAILANNGDQQEALLCQL
SESSMLLAQLGALVSEGVERLVQTHGLALEEETNEGDNDMEKRKHEYLRFGKRKHEYLRF
GKRKHEYLRFGKRKHEYLRFGRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86059
NameBDBM86059
Synonyms:CAS_6830 | GTP | NSC_6830
TypeSmall organic molecule
Emp. Form.C10H16N5O14P3
Mol. Mass.523.1804
SMILESNc1nc2n(cnc2c(=O)[nH]1)C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O
Structure
n/a