Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM84742
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_5207
Citation Knight, ARMisra, AQuirk, KBenwell, KRevell, DKennett, GBickerdike, M Pharmacological characterisation of the agonist radioligand binding site of 5-HT(2A), 5-HT(2B) and 5-HT(2C) receptors. Naunyn Schmiedebergs Arch Pharmacol370:114-23 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 2A
Name:5-hydroxytryptamine receptor 2A
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2 | HTR2A | Serotonin receptor 2A
Type:undefined
Mol. Mass.:52607.65
Organism:Homo sapiens (Human)
Description:P28223
Residue:471
Sequence:
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84742
NameBDBM84742
Synonyms:CAS_106650-56-0 | NSC_5210 | sibutramine
TypeSmall organic molecule
Emp. Form.C17H26ClN
Mol. Mass.279.848
SMILESCC(C)CC(N(C)C)C1(CCC1)c1ccc(Cl)cc1
Structure
n/a