BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVma11p
LigandBDBM63397
Substrate/Competitorn/a
Meas. Tech.Dose Response of Small Molecules that Regulate V-ATPase Proton Transport in Yeast using pHLuorin, Cherry Pick 2
EC50 2367±n/a nM
Citation PubChem, PC Dose Response of Small Molecules that Regulate V-ATPase Proton Transport in Yeast using pHLuorin, Cherry Pick 2 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
Vma11p
Name:Vma11p
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:17039.28
Organism:Saccharomyces cerevisiae S288c
Description:gi_6325022
Residue:164
Sequence:
MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL
IPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVG
DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM63397
NameBDBM63397
Synonyms:MLS000723546 | SMR000305141 | cid_5833488 | ethyl (2Z)-2-(9H-indeno[1,2-b][1,2,5]oxadiazolo[3,4-e]pyrazin-9-ylidene)hydrazinecarboxylate
TypeSmall organic molecule
Emp. Form.C14H10N6O3
Mol. Mass.310.2676
SMILESCCOC(=O)N\N=C1\c2ccccc2-c2nc3nonc3nc12
Structure
n/a