BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVma11p
LigandBDBM88691
Substrate/Competitorn/a
Meas. Tech.Dose Response with BCECF Assay for V-ATPase inhibitors that increase vacuolar pH, Powder Set 1
EC50 728±n/a nM
Citation PubChem, PC Dose Response with BCECF Assay for V-ATPase inhibitors that increase vacuolar pH, Powder Set 1 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
Vma11p
Name:Vma11p
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:17039.28
Organism:Saccharomyces cerevisiae S288c
Description:gi_6325022
Residue:164
Sequence:
MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL
IPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVG
DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM88691
NameBDBM88691
Synonyms:VU0465039-1 | [4-(6-methoxy-1,3-benzothiazol-2-yl)-1-piperazinyl]-(5-nitro-2-furanyl)methanone | [4-(6-methoxy-1,3-benzothiazol-2-yl)piperazin-1-yl]-(5-nitrofuran-2-yl)methanone | [4-(6-methoxy-1,3-benzothiazol-2-yl)piperazino]-(5-nitro-2-furyl)methanone | cid_7538979
TypeSmall organic molecule
Emp. Form.C17H16N4O5S
Mol. Mass.388.398
SMILESCOc1ccc2nc(sc2c1)N1CCN(CC1)C(=O)c1ccc(o1)[N+]([O-])=O
Structure
n/a