BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVma11p
LigandBDBM87567
Substrate/Competitorn/a
Meas. Tech.Dose Response with BCECF Assay for V-ATPase inhibitors that increase vacuolar pH, Powder Set 1
EC50 384±n/a nM
Citation PubChem, PC Dose Response with BCECF Assay for V-ATPase inhibitors that increase vacuolar pH, Powder Set 1 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
Vma11p
Name:Vma11p
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:17039.28
Organism:Saccharomyces cerevisiae S288c
Description:gi_6325022
Residue:164
Sequence:
MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL
IPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVG
DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM87567
NameBDBM87567
Synonyms:MLS001234266 | SMR000811639 | [4-(6-fluoranyl-1,3-benzothiazol-2-yl)piperazin-1-yl]-(5-nitrofuran-2-yl)methanone | [4-(6-fluoro-1,3-benzothiazol-2-yl)-1-piperazinyl]-(5-nitro-2-furanyl)methanone | [4-(6-fluoro-1,3-benzothiazol-2-yl)piperazin-1-yl]-(5-nitrofuran-2-yl)methanone | [4-(6-fluoro-1,3-benzothiazol-2-yl)piperazino]-(5-nitro-2-furyl)methanone | cid_7539130
TypeSmall organic molecule
Emp. Form.C16H13FN4O4S
Mol. Mass.376.362
SMILES[O-][N+](=O)c1ccc(o1)C(=O)N1CCN(CC1)c1nc2ccc(F)cc2s1
Structure
n/a